PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_001956-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 221aa    MW: 24729.4 Da    PI: 9.1658
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_001956-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding64.22.5e-204085147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W+teEd++l ++v+++G ++W++I+r+++ gR++k+c++rw + 
    NNU_001956-RA 40 KGPWSTEEDKILTRLVNRHGARNWSLISRYIP-GRSGKSCRLRWCNQ 85
                     79******************************.***********985 PP

2Myb_DNA-binding53.74.8e-1794136347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++++ Ede ++ a++ +G++ W+tIar ++ gRt++ +k++w++ 
    NNU_001956-RA  94 PFSPAEDETILAAHASYGNR-WATIARLLP-GRTDNAVKNHWNST 136
                      79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.0193590IPR017930Myb domain
SuperFamilySSF466892.8E-3138133IPR009057Homeodomain-like
SMARTSM007175.8E-173988IPR001005SANT/Myb domain
PfamPF002494.6E-194085IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.0E-254193IPR009057Homeodomain-like
CDDcd001672.05E-154284No hitNo description
SMARTSM007175.7E-1591139IPR001005SANT/Myb domain
PROSITE profilePS5129421.09492141IPR017930Myb domain
CDDcd001671.25E-1194137No hitNo description
PfamPF002494.1E-1494136IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.0E-2394140IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    Send to blast
MEAIYTYSSP STSSSDSSES ESSHPGNKQM GSTKKSERIK GPWSTEEDKI LTRLVNRHGA  60
RNWSLISRYI PGRSGKSCRL RWCNQLSPNV EHRPFSPAED ETILAAHASY GNRWATIARL  120
LPGRTDNAVK NHWNSTLKRR QREQPVEDNN GGRSLESGSS SETKPDPPTT LTLAPPGVSC  180
SLPERRMENF SSEFWDMMRE VIAKEVRNYV SSSLAETAGF P
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-39391406107B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010268609.11e-163PREDICTED: transcriptional activator Myb-like
TrEMBLA0A067KQI31e-88A0A067KQI3_JATCU; MYB family protein
STRINGVIT_18s0001g11170.t014e-85(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.17e-58myb domain protein 73